PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI02G23310.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CO-like
Protein Properties Length: 335aa    MW: 35274.3 Da    PI: 4.9349
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI02G23310.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box261.9e-083269438
         zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg....Ht 38
                     r C+ ++ + ++l+C+ ++ +lC+ C    H g    H 
  OMERI02G23310.1 32 RACDSCGAEAARLYCRADGAFLCARCDARAH-GagsrHA 69
                     57**************************999.4466675 PP

2zf-B_box22.91.8e-0771115341
         zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41 
                       + C+ +e+ ++   C+ +   lC+ C   +H+       H++ p
  OMERI02G23310.1  71 VWLCEVCEHAPAAVTCRADAAALCAACDADIHSAnplarrHERLP 115
                      679*****************************6688888898877 PP

3CCT70.44.5e-24264307144
              CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                      Rea+l+RY+eKrk+R+F+K+irY+sRKa+Ae+RpR+KGrF+k++
  OMERI02G23310.1 264 REARLMRYREKRKNRRFDKTIRYASRKAYAETRPRIKGRFAKRT 307
                      9****************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.9932973IPR000315B-box-type zinc finger
SMARTSM003368.4E-92973IPR000315B-box-type zinc finger
CDDcd000215.75E-103273No hitNo description
PfamPF006431.9E-63368IPR000315B-box-type zinc finger
PROSITE profilePS5011910.42469116IPR000315B-box-type zinc finger
PfamPF006438.0E-671116IPR000315B-box-type zinc finger
SMARTSM003364.6E-974116IPR000315B-box-type zinc finger
PROSITE profilePS5101716.916264306IPR010402CCT domain
PfamPF062032.7E-18264306IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010099Biological Processregulation of photomorphogenesis
GO:0010161Biological Processred light signaling pathway
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MEAAEDKAMV VGVGGAVAAG YSSSSSWGLG TRACDSCGAE AARLYCRADG AFLCARCDAR  60
AHGAGSRHAR VWLCEVCEHA PAAVTCRADA AALCAACDAD IHSANPLARR HERLPVAPFF  120
GSLADSPQPF PFSQAAADDA AAAREEDADD DRSKEAEAAS WLLPEPDDNS HEDSAAAADA  180
FFADTGAYLG VDLDFARSMD GIKAIGVPVA PPELDLTAGS LFYPEHSMTH SLSSSEVAIV  240
PDALSAGAAA PPMVVVVASK GKEREARLMR YREKRKNRRF DKTIRYASRK AYAETRPRIK  300
GRFAKRTADA DDDDEAPCSP AFSALAASDG VVPSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1000970.0AK100097.1 Oryza sativa Japonica Group cDNA clone:J023004D12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015625855.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 3
TrEMBLA0A0E0CN960.0A0A0E0CN96_9ORYZ; Uncharacterized protein
STRINGBGIOSGA008605-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21913272
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.15e-36CONSTANS-like 2